Recombinant Human CSE1L
| Cat.No. : | CSE1L-27394TH |
| Product Overview : | Recombinant fragment of Human Cellular Apoptosis Susceptibility with N terminal proprietary tag, predicted mwt: 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Highly expressed in proliferating cells. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAASVTLL |
| Sequence Similarities : | Belongs to the XPO2/CSE1 family.Contains 1 importin N-terminal domain. |
| Gene Name | CSE1L CSE1 chromosome segregation 1-like (yeast) [ Homo sapiens ] |
| Official Symbol | CSE1L |
| Synonyms | CSE1L; CSE1 chromosome segregation 1-like (yeast); chromosome segregation 1 (yeast homolog) like; exportin-2; CAS; CSE1; XPO2; |
| Gene ID | 1434 |
| mRNA Refseq | NM_001316 |
| Protein Refseq | NP_001307 |
| MIM | 601342 |
| Uniprot ID | P55060 |
| Chromosome Location | 20q13 |
| Pathway | Direct p53 effectors, organism-specific biosystem; p53 pathway, organism-specific biosystem; |
| Function | importin-alpha export receptor activity; protein binding; protein transporter activity; |
| ◆ Recombinant Proteins | ||
| CSE1L-1959H | Recombinant Human CSE1L Protein, GST-tagged | +Inquiry |
| CSE1L-9523H | Recombinant Human CSE1L protein, MYC/DDK-tagged | +Inquiry |
| CSE1L-2732H | Recombinant Human CSE1L Protein (1-200 aa), His-SUMO-tagged | +Inquiry |
| CSE1L-670H | Recombinant Human CSE1L Protein, His (Fc)-Avi-tagged | +Inquiry |
| CSE1L-27953TH | Recombinant Human CSE1L | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSE1L Products
Required fields are marked with *
My Review for All CSE1L Products
Required fields are marked with *
