Recombinant Full Length Human CSNK1A1L Protein, GST-tagged

Cat.No. : CSNK1A1L-2190HF
Product Overview : Human CSNK1A1L full-length ORF ( AAH28723, 1 a.a. - 337 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 337 amino acids
Description : CSNK1A1L (Casein Kinase 1 Alpha 1 Like) is a Protein Coding gene. Among its related pathways are Wnt Signaling Pathway and Pluripotency and Regulation of lipid metabolism Insulin signaling-generic cascades. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CSNK1A1.
Molecular Mass : 62.81 kDa
AA Sequence : MTNNSGSKAELVVGGKYKLVRKIGSGSFGDVYLGITTTNGEEVAVKLESQKVKHPQLLYESKLYTILQGGVGIPHMHWYGQEKDNNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFLHRDIKPDNFLMGTGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKHLIGTVRYASINAHLGIEQSRRDDMESLGYVFMYFNRTSLPWQGLKAMTKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEVPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKDN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CSNK1A1L casein kinase 1, alpha 1-like [ Homo sapiens ]
Official Symbol CSNK1A1L
Synonyms CSNK1A1L; casein kinase 1, alpha 1-like; casein kinase I isoform alpha-like; MGC33182; CKI-alpha-like; casein kinase I alpha S-like; CK1
Gene ID 122011
mRNA Refseq NM_145203
Protein Refseq NP_660204
UniProt ID Q8N752

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSNK1A1L Products

Required fields are marked with *

My Review for All CSNK1A1L Products

Required fields are marked with *

0
cart-icon
0
compare icon