Recombinant Full Length Human CSNK1A1L Protein, GST-tagged
| Cat.No. : | CSNK1A1L-2190HF |
| Product Overview : | Human CSNK1A1L full-length ORF ( AAH28723, 1 a.a. - 337 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 337 amino acids |
| Description : | CSNK1A1L (Casein Kinase 1 Alpha 1 Like) is a Protein Coding gene. Among its related pathways are Wnt Signaling Pathway and Pluripotency and Regulation of lipid metabolism Insulin signaling-generic cascades. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CSNK1A1. |
| Molecular Mass : | 62.81 kDa |
| AA Sequence : | MTNNSGSKAELVVGGKYKLVRKIGSGSFGDVYLGITTTNGEEVAVKLESQKVKHPQLLYESKLYTILQGGVGIPHMHWYGQEKDNNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFLHRDIKPDNFLMGTGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKHLIGTVRYASINAHLGIEQSRRDDMESLGYVFMYFNRTSLPWQGLKAMTKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEVPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKDN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CSNK1A1L casein kinase 1, alpha 1-like [ Homo sapiens ] |
| Official Symbol | CSNK1A1L |
| Synonyms | CSNK1A1L; casein kinase 1, alpha 1-like; casein kinase I isoform alpha-like; MGC33182; CKI-alpha-like; casein kinase I alpha S-like; CK1 |
| Gene ID | 122011 |
| mRNA Refseq | NM_145203 |
| Protein Refseq | NP_660204 |
| UniProt ID | Q8N752 |
| ◆ Recombinant Proteins | ||
| CSNK1A1L-2190HF | Recombinant Full Length Human CSNK1A1L Protein, GST-tagged | +Inquiry |
| CSNK1A1L-343H | Recombinant Human CSNK1A1L Protein, His-tagged | +Inquiry |
| CSNK1A1L-1990H | Recombinant Human CSNK1A1L Protein, GST-tagged | +Inquiry |
| CSNK1A1L-1059R | Recombinant Rhesus monkey CSNK1A1L Protein, His-tagged | +Inquiry |
| CSNK1A1L-884R | Recombinant Rhesus Macaque CSNK1A1L Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CSNK1A1L-7243HCL | Recombinant Human CSNK1A1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSNK1A1L Products
Required fields are marked with *
My Review for All CSNK1A1L Products
Required fields are marked with *
