Recombinant Full Length Human CSRP2 Protein, C-Flag-tagged
Cat.No. : | CSRP2-840HFL |
Product Overview : | Recombinant Full Length Human CSRP2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth. Other genes in the family include CSRP1 and CSRP3. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 20.8 kDa |
AA Sequence : | MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKG YGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWH KNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CSRP2 cysteine and glycine rich protein 2 [ Homo sapiens (human) ] |
Official Symbol | CSRP2 |
Synonyms | CRP2; LMO5; SmLIM |
Gene ID | 1466 |
mRNA Refseq | NM_001321.3 |
Protein Refseq | NP_001312.1 |
MIM | 601871 |
UniProt ID | Q16527 |
◆ Recombinant Proteins | ||
CSRP2-2219HF | Recombinant Full Length Human CSRP2 Protein, GST-tagged | +Inquiry |
Csrp2-2344M | Recombinant Mouse Csrp2 Protein, Myc/DDK-tagged | +Inquiry |
CSRP2-2019H | Recombinant Human CSRP2 Protein, GST-tagged | +Inquiry |
CSRP2-6761C | Recombinant Chicken CSRP2 | +Inquiry |
CSRP2-2031M | Recombinant Mouse CSRP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSRP2-7232HCL | Recombinant Human CSRP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSRP2 Products
Required fields are marked with *
My Review for All CSRP2 Products
Required fields are marked with *
0
Inquiry Basket