Recombinant Full Length Human CST1 Protein, GST-tagged

Cat.No. : CST1-2232HF
Product Overview : Human CST1 full-length ORF ( NP_001889.2, 1 a.a. - 141 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 141 amino acids
Description : The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a cysteine proteinase inhibitor found in saliva, tears, urine, and seminal fluid. [provided by RefSeq, Jul 2008]
Molecular Mass : 42.8 kDa
AA Sequence : MAQYLSTLLLLLATLAVALAWSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CST1 cystatin SN [ Homo sapiens ]
Official Symbol CST1
Synonyms CST1; cystatin SN; cystatin-SN; cystatin 1; cystatin-1; cystain-SA-I; cystatin SA-I; salivary cystatin-SA-1; cysteine proteinase inhibitor, type 2 family
Gene ID 1469
mRNA Refseq NM_001898
Protein Refseq NP_001889
MIM 123855
UniProt ID P01037

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CST1 Products

Required fields are marked with *

My Review for All CST1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon