Recombinant Full Length Human CST4 Protein
Cat.No. : | CST4-97HF |
Product Overview : | Recombinant full length Human Cystatin S with N terminal proprietary tag; Predicted MWt 41.58 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 141 amino acids |
Description : | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a type 2 salivary cysteine peptidase inhibitor. The protein is an S-type cystatin, based on its high level of expression in saliva, tears and seminal plasma. The specific role in these fluids is unclear but antibacterial and antiviral activity is present, consistent with a protective function. |
Form : | Liquid |
Molecular Mass : | 41.580kDa inclusive of tags |
AA Sequence : | MARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLN DEWVQRALHFAISEYNKATEDEYYRRPLQVLRAREQTFGG VNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSF EIYEVPWEDRMSLVNSRCQEA |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CST4 cystatin S [ Homo sapiens ] |
Official Symbol | CST4 |
Synonyms | CST4; cystatin S; cystatin-S |
Gene ID | 1472 |
mRNA Refseq | NM_001899 |
Protein Refseq | NP_001890 |
MIM | 123857 |
UniProt ID | P01036 |
◆ Recombinant Proteins | ||
CST4-189H | Recombinant Human CST4 Protein, His-tagged | +Inquiry |
CYSS-1171S | Recombinant Streptomyces coelicolor A3(2) CYSS protein, His-tagged | +Inquiry |
CST4-1304R | Recombinant Rat CST4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CST4-97HF | Recombinant Full Length Human CST4 Protein | +Inquiry |
CST4-3212H | Recombinant Human CST4 protein(Met1-Ala141), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CST4-2241HCL | Recombinant Human CST4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CST4 Products
Required fields are marked with *
My Review for All CST4 Products
Required fields are marked with *
0
Inquiry Basket