Recombinant Full Length Human CT45A6 Protein, GST-tagged
Cat.No. : | CT45A6-2255HF |
Product Overview : | Human CT45-6 full-length ORF ( NP_001017438.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 189 amino acids |
Description : | CT45A6 (Cancer/Testis Antigen Family 45 Member A6) is a Protein Coding gene. An important paralog of this gene is CT45A5. |
Molecular Mass : | 47.19 kDa |
AA Sequence : | MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMTGHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQQEINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CT45A6 cancer/testis antigen family 45 member A6 [ Homo sapiens (human) ] |
Official Symbol | CT45A6 |
Synonyms | CT45A6; cancer/testis antigen family 45 member A6; Cancer/Testis Antigen Family 45 Member A6; Cancer/Testis Antigen CT45-6; Cancer/Testis Antigen 45-6; Cancer/Testis Antigen 45A6; CT45-6; Cancer/Testis Antigen Family 45 Member A4/A6; Cancer/Testis Antigen 45A4/45A6; Cancer/Testis Antigen 45-4/6; CT45.6; cancer/testis antigen family 45 member A6; cancer/testis antigen 45-4/6; cancer/testis antigen 45-6; cancer/testis antigen 45A4/45A6; cancer/testis antigen 45A6; cancer/testis antigen CT45-6; cancer/testis antigen family 45 member A4/A6 |
Gene ID | 541465 |
mRNA Refseq | NM_001017438 |
Protein Refseq | NP_001017438 |
MIM | 300797 |
UniProt ID | P0DMU7 |
◆ Recombinant Proteins | ||
CT45A6-3050H | Recombinant Human CT45A6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CT45A6-2046H | Recombinant Human CT45A6 Protein, GST-tagged | +Inquiry |
CT45A6-3363H | Recombinant Human CT45A6 Protein, MYC/DDK-tagged | +Inquiry |
CT45A6-2255HF | Recombinant Full Length Human CT45A6 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CT45A6 Products
Required fields are marked with *
My Review for All CT45A6 Products
Required fields are marked with *