Recombinant Full Length Human CT45A6 Protein, GST-tagged

Cat.No. : CT45A6-2255HF
Product Overview : Human CT45-6 full-length ORF ( NP_001017438.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 189 amino acids
Description : CT45A6 (Cancer/Testis Antigen Family 45 Member A6) is a Protein Coding gene. An important paralog of this gene is CT45A5.
Molecular Mass : 47.19 kDa
AA Sequence : MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMTGHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQQEINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CT45A6 cancer/testis antigen family 45 member A6 [ Homo sapiens (human) ]
Official Symbol CT45A6
Synonyms CT45A6; cancer/testis antigen family 45 member A6; Cancer/Testis Antigen Family 45 Member A6; Cancer/Testis Antigen CT45-6; Cancer/Testis Antigen 45-6; Cancer/Testis Antigen 45A6; CT45-6; Cancer/Testis Antigen Family 45 Member A4/A6; Cancer/Testis Antigen 45A4/45A6; Cancer/Testis Antigen 45-4/6; CT45.6; cancer/testis antigen family 45 member A6; cancer/testis antigen 45-4/6; cancer/testis antigen 45-6; cancer/testis antigen 45A4/45A6; cancer/testis antigen 45A6; cancer/testis antigen CT45-6; cancer/testis antigen family 45 member A4/A6
Gene ID 541465
mRNA Refseq NM_001017438
Protein Refseq NP_001017438
MIM 300797
UniProt ID P0DMU7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CT45A6 Products

Required fields are marked with *

My Review for All CT45A6 Products

Required fields are marked with *

0
cart-icon
0
compare icon