Recombinant Full Length Human CTBS Protein, GST-tagged
| Cat.No. : | CTBS-2209HF |
| Product Overview : | Human CTBS full-length ORF ( AAH24007.2, 37 a.a. - 105 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 105 amino acids |
| Description : | Chitobiase is a lysosomal glycosidase involved in degradation of asparagine-linked oligosaccharides on glycoproteins (Aronson and Kuranda, 1989 [PubMed 2531691]).[supplied by OMIM, Nov 2010] |
| Molecular Mass : | 33.22 kDa |
| AA Sequence : | DCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGNL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CTBS chitobiase, di-N-acetyl- [ Homo sapiens ] |
| Official Symbol | CTBS |
| Synonyms | CTBS; chitobiase, di-N-acetyl-; CTB; di-N-acetylchitobiase |
| Gene ID | 1486 |
| mRNA Refseq | NM_004388 |
| Protein Refseq | NP_004379 |
| MIM | 600873 |
| UniProt ID | Q01459 |
| ◆ Recombinant Proteins | ||
| CTBS-2056H | Recombinant Human CTBS Protein, GST-tagged | +Inquiry |
| CTBS-2209HF | Recombinant Full Length Human CTBS Protein, GST-tagged | +Inquiry |
| CTBS-4011M | Recombinant Mouse CTBS Protein | +Inquiry |
| CTBS-1862H | Recombinant Human CTBS Protein (Glu47-Arg385), N-His tagged | +Inquiry |
| CTBS-1658H | Recombinant Human CTBS protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTBS-7214HCL | Recombinant Human CTBS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTBS Products
Required fields are marked with *
My Review for All CTBS Products
Required fields are marked with *
