Recombinant Human CTBS Protein, GST-tagged
Cat.No. : | CTBS-2056H |
Product Overview : | Human CTBS full-length ORF ( AAH24007.2, 37 a.a. - 105 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Chitobiase is a lysosomal glycosidase involved in degradation of asparagine-linked oligosaccharides on glycoproteins (Aronson and Kuranda, 1989 [PubMed 2531691]).[supplied by OMIM, Nov 2010] |
Molecular Mass : | 33.22 kDa |
AA Sequence : | DCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGNL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CTBS chitobiase, di-N-acetyl- [ Homo sapiens ] |
Official Symbol | CTBS |
Synonyms | CTBS; chitobiase, di-N-acetyl-; CTB; di-N-acetylchitobiase; |
Gene ID | 1486 |
mRNA Refseq | NM_004388 |
Protein Refseq | NP_004379 |
MIM | 600873 |
UniProt ID | Q01459 |
◆ Recombinant Proteins | ||
CTBS-1650R | Recombinant Rat CTBS Protein | +Inquiry |
CTBS-2056H | Recombinant Human CTBS Protein, GST-tagged | +Inquiry |
Ctbs-2353M | Recombinant Mouse Ctbs Protein, Myc/DDK-tagged | +Inquiry |
CTBS-4011M | Recombinant Mouse CTBS Protein | +Inquiry |
CTBS-1309R | Recombinant Rat CTBS Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTBS-7214HCL | Recombinant Human CTBS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTBS Products
Required fields are marked with *
My Review for All CTBS Products
Required fields are marked with *