Recombinant Full Length Human CTDSPL2 Protein, GST-tagged
Cat.No. : | CTDSPL2-2270HF |
Product Overview : | Human CTDSPL2 full-length ORF ( NP_057480.2, 1 a.a. - 466 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 466 amino acids |
Description : | CTDSPL2 (CTD Small Phosphatase Like 2) is a Protein Coding gene. GO annotations related to this gene include phosphatase activity and phosphoprotein phosphatase activity. An important paralog of this gene is CTDSPL. |
Molecular Mass : | 79.4 kDa |
AA Sequence : | MRLRTRKASQQSNQIQTQRTARAKRKYSEVDDSLPSGGEKPSKNETGLLSSIKKFIKGSTPKEERENPSKRSRIERDIDNNLITSTPRAGEKPNKQISRVRRKSQVNGEAGSYEMTNQHVKQNGKLEDNPSSGSPPRTTLLGTIFSPVFNFFSPANKNGTSGSDSPGQAVEAEEIVKQLDMEQVDEITTSTTTSTNGAAYSNQAVQVRPSLNNGLEEAEETVNRDIPPLTAPVTPDSGYSSAHAEATYEEDWEVFDPYYFIKHVPPLTEEQLNRKPALPLKTRSTPEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDVIYQVYVRLRPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLEKLVELNEDVRPHIRDRFRLHDLLPPD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CTDSPL2 CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2 [ Homo sapiens ] |
Official Symbol | CTDSPL2 |
Synonyms | CTDSPL2; CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2; CTD small phosphatase-like protein 2; FLJ10523; HSPC129; CTDSP-like 2; HSPC058 |
Gene ID | 51496 |
mRNA Refseq | NM_016396 |
Protein Refseq | NP_057480 |
MIM | 618739 |
UniProt ID | Q05D32 |
◆ Recombinant Proteins | ||
CTDSPL2-2064H | Recombinant Human CTDSPL2 Protein, GST-tagged | +Inquiry |
CTDSPL2-2002C | Recombinant Chicken CTDSPL2 | +Inquiry |
CTDSPL2-901R | Recombinant Rhesus Macaque CTDSPL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CTDSPL2-2270HF | Recombinant Full Length Human CTDSPL2 Protein, GST-tagged | +Inquiry |
Ctdspl2-2356M | Recombinant Mouse Ctdspl2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTDSPL2-7206HCL | Recombinant Human CTDSPL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTDSPL2 Products
Required fields are marked with *
My Review for All CTDSPL2 Products
Required fields are marked with *