Recombinant Full Length Human CTHRC1 Protein, C-Flag-tagged
Cat.No. : | CTHRC1-400HFL |
Product Overview : | Recombinant Full Length Human CTHRC1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This locus encodes a protein that may play a role in the cellular response to arterial injury through involvement in vascular remodeling. Mutations at this locus have been associated with Barrett esophagus and esophageal adenocarcinoma. Alternatively spliced transcript variants have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 26 kDa |
AA Sequence : | MRPQGPAASPQRLRGLLLLLLLQLPAPSSASEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPG ANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVL FSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVD VAIWVGTCSDYPKGDASTGWNSVSRIIIEELPKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | CTHRC1 collagen triple helix repeat containing 1 [ Homo sapiens (human) ] |
Official Symbol | CTHRC1 |
Synonyms | collagen triple helix repeat containing 1 |
Gene ID | 115908 |
mRNA Refseq | NM_138455.4 |
Protein Refseq | NP_612464.1 |
MIM | 610635 |
UniProt ID | Q96CG8 |
◆ Recombinant Proteins | ||
CTHRC1-2053M | Recombinant Mouse CTHRC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CTHRC1-1738H | Recombinant Human CTHRC1 Protein (Ser31-Lys243), N-His tagged | +Inquiry |
Cthrc1-28M | Recombinant Mouse Cthrc1 protein, FLAG®-tagged | +Inquiry |
CTHRC1-4024M | Recombinant Mouse CTHRC1 Protein | +Inquiry |
CTHRC1-5254H | Recombinant Human CTHRC1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTHRC1-2448HCL | Recombinant Human CTHRC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTHRC1 Products
Required fields are marked with *
My Review for All CTHRC1 Products
Required fields are marked with *
0
Inquiry Basket