Recombinant Full Length Human CTNNBIP1 Protein, C-Flag-tagged

Cat.No. : CTNNBIP1-1844HFL
Product Overview : Recombinant Full Length Human CTNNBIP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 9 kDa
AA Sequence : MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMA FSRSETEDRRQ myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Transcription Factors
Protein Pathways : Wnt signaling pathway
Full Length : Full L.
Gene Name CTNNBIP1 catenin beta interacting protein 1 [ Homo sapiens (human) ]
Official Symbol CTNNBIP1
Synonyms ICAT
Gene ID 56998
mRNA Refseq NM_001012329.2
Protein Refseq NP_001012329.1
MIM 607758
UniProt ID Q9NSA3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTNNBIP1 Products

Required fields are marked with *

My Review for All CTNNBIP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon