Recombinant Full Length Human CTNNBIP1 Protein, C-Flag-tagged
Cat.No. : | CTNNBIP1-1844HFL |
Product Overview : | Recombinant Full Length Human CTNNBIP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 9 kDa |
AA Sequence : | MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMA FSRSETEDRRQ myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Protein Pathways : | Wnt signaling pathway |
Full Length : | Full L. |
Gene Name | CTNNBIP1 catenin beta interacting protein 1 [ Homo sapiens (human) ] |
Official Symbol | CTNNBIP1 |
Synonyms | ICAT |
Gene ID | 56998 |
mRNA Refseq | NM_001012329.2 |
Protein Refseq | NP_001012329.1 |
MIM | 607758 |
UniProt ID | Q9NSA3 |
◆ Recombinant Proteins | ||
Ctnnbip1-2361M | Recombinant Mouse Ctnnbip1 Protein, Myc/DDK-tagged | +Inquiry |
CTNNBIP1-3377H | Recombinant Human CTNNBIP1 Protein, MYC/DDK-tagged | +Inquiry |
CTNNBIP1-2585H | Recombinant Human Catenin, Beta Interacting Protein 1, His-tagged | +Inquiry |
CTNNBIP1-5635C | Recombinant Chicken CTNNBIP1 | +Inquiry |
CTNNBIP1-906R | Recombinant Rhesus Macaque CTNNBIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTNNBIP1 Products
Required fields are marked with *
My Review for All CTNNBIP1 Products
Required fields are marked with *
0
Inquiry Basket