Recombinant Full Length Human CTNNBIP1 Protein, C-Flag-tagged

• Cat.No.: CTNNBIP1-1844HFL
• Product Overview: Recombinant Full Length Human CTNNBIP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 9 kDa
• AA Sequence: MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMA FSRSETEDRRQ myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Wnt signaling pathway
• Full Length: Full L.

Gene Information

• Gene Name: CTNNBIP1 catenin beta interacting protein 1 [ Homo sapiens (human) ]
• Official Symbol: CTNNBIP1
• Synonyms: ICAT
• Gene ID: 56998
• mRNA Refseq: NM_001012329.2
• Protein Refseq: NP_001012329.1
• MIM: 607758
• UniProt ID: Q9NSA3