Recombinant Human CTNNBIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CTNNBIP1-5814H
• Product Overview: CTNNBIP1 MS Standard C13 and N15-labeled recombinant protein (NP_001012329) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene.
• Molecular Mass: 9 kDa
• AA Sequence: MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CTNNBIP1 catenin beta interacting protein 1 [ Homo sapiens (human) ]
• Official Symbol: CTNNBIP1
• Synonyms: CTNNBIP1; catenin, beta interacting protein 1; beta-catenin-interacting protein 1; beta catenin interacting protein ICAT; ICAT; inhibitor of beta catenin and Tcf 4; MGC15093; inhibitor of beta-catenin and Tcf-4; beta-catenin-interacting protein ICAT
• Gene ID: 56998
• mRNA Refseq: NM_001012329
• Protein Refseq: NP_001012329
• MIM: 607758
• UniProt ID: Q9NSA3