Recombinant Human CTNNBIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CTNNBIP1-5814H
Product Overview : CTNNBIP1 MS Standard C13 and N15-labeled recombinant protein (NP_001012329) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene.
Molecular Mass : 9 kDa
AA Sequence : MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CTNNBIP1 catenin beta interacting protein 1 [ Homo sapiens (human) ]
Official Symbol CTNNBIP1
Synonyms CTNNBIP1; catenin, beta interacting protein 1; beta-catenin-interacting protein 1; beta catenin interacting protein ICAT; ICAT; inhibitor of beta catenin and Tcf 4; MGC15093; inhibitor of beta-catenin and Tcf-4; beta-catenin-interacting protein ICAT;
Gene ID 56998
mRNA Refseq NM_001012329
Protein Refseq NP_001012329
MIM 607758
UniProt ID Q9NSA3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTNNBIP1 Products

Required fields are marked with *

My Review for All CTNNBIP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon