Recombinant Full Length Human CTSL Protein, C-Flag-tagged
Cat.No. : | CTSL-1680HFL |
Product Overview : | Recombinant Full Length Human CTSL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a lysosomal cysteine proteinase that plays a major role in intracellular protein catabolism. Its substrates include collagen and elastin, as well as alpha-1 protease inhibitor, a major controlling element of neutrophil elastase activity. The encoded protein has been implicated in several pathologic processes, including myofibril necrosis in myopathies and in myocardial ischemia, and in the renal tubular response to proteinuria. This protein, which is a member of the peptidase C1 family, is a dimer composed of disulfide-linked heavy and light chains, both produced from a single protein precursor. Additionally, this protein cleaves the S1 subunit of the SARS-CoV-2 spike protein, which is necessary for entry of the virus into the cell. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35.8 kDa |
AA Sequence : | MNPTLILAAFCLGIASATLTFDHSLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNVKMIELHNQEYREGK HSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWA FSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEES CKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLV VGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease |
Protein Pathways : | Antigen processing and presentation, Lysosome |
Full Length : | Full L. |
Gene Name | CTSL cathepsin L [ Homo sapiens (human) ] |
Official Symbol | CTSL |
Synonyms | MEP; CATL; CTSL1 |
Gene ID | 1514 |
mRNA Refseq | NM_001912.5 |
Protein Refseq | NP_001903.1 |
MIM | 116880 |
UniProt ID | P07711 |
◆ Recombinant Proteins | ||
CTSL-1063H | Recombinant Human CTSL Protein (Thr18-Val333), C-His tagged | +Inquiry |
CTSL-2357HF | Recombinant Full Length Human CTSL Protein, GST-tagged | +Inquiry |
CTSL1-405H | Active Recombinant Human CTSL Protein, His-tagged | +Inquiry |
Ctsl-823M | Recombinant Mouse Ctsl Protein, His-tagged | +Inquiry |
CTSL-2070M | Recombinant Mouse CTSL Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CTSL-191H | Active Native Human Cathepsin L | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSL1-1867MCL | Recombinant Mouse CTSL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSL Products
Required fields are marked with *
My Review for All CTSL Products
Required fields are marked with *
0
Inquiry Basket