Recombinant Human CTSL, His-tagged
| Cat.No. : | CTSL-54H |
| Product Overview : | Recombinant Human Cathepsin L is produced by our mammalian expression system in human cells. The target protein is expressed with the full length sequence of Human Cathepsin L fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Form : | Supplied as a 0.2 μM filtered solution of 20mM HAc-NaAc, 150mM NaCl, pH 4.5 |
| AA Sequence : | TLTFDHSLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNVKMIELHNQEYREGKHSFTMAMNAFGD MTSEEFRQVMNGFQNRKPRKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGAL EGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCK YNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHG VLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTVVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Storage : | Store at Please minimize freeze-thaw cycles. |
| Full Length : | Full L. |
| ◆ Recombinant Proteins | ||
| CTSL-2070M | Recombinant Mouse CTSL Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ctsl-38M | Recombinant Mouse Ctsl Protein, His-tagged | +Inquiry |
| CTSL-1680HFL | Recombinant Full Length Human CTSL Protein, C-Flag-tagged | +Inquiry |
| CTSL1-405H | Active Recombinant Human CTSL Protein, His-tagged | +Inquiry |
| CTSL-2113H | Recombinant Human CTSL Protein, GST-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CTSL-191H | Active Native Human Cathepsin L | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTSL1-1867MCL | Recombinant Mouse CTSL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSL Products
Required fields are marked with *
My Review for All CTSL Products
Required fields are marked with *



