Recombinant Human CTSL, His-tagged
Cat.No. : | CTSL-54H |
Product Overview : | Recombinant Human Cathepsin L is produced by our mammalian expression system in human cells. The target protein is expressed with the full length sequence of Human Cathepsin L fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Form : | Supplied as a 0.2 μM filtered solution of 20mM HAc-NaAc, 150mM NaCl, pH 4.5 |
AA Sequence : | TLTFDHSLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNVKMIELHNQEYREGKHSFTMAMNAFGD MTSEEFRQVMNGFQNRKPRKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGAL EGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCK YNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHG VLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTVVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at Please minimize freeze-thaw cycles. |
Full Length : | Full L. |
◆ Recombinant Proteins | ||
Ctsl-422M | Recombinant Mouse Ctsl Protein, His/GST-tagged | +Inquiry |
Ctsl-5418M | Recombinant Mouse Ctsl Protein (Thr18-Asn334), C-His tagged | +Inquiry |
CTSL-1063H | Recombinant Human CTSL Protein (Thr18-Val333), C-His tagged | +Inquiry |
CTSL-54H | Recombinant Human CTSL, His-tagged | +Inquiry |
CTSL-3380H | Recombinant Human CTSL Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
CTSL-191H | Active Native Human Cathepsin L | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSL1-1867MCL | Recombinant Mouse CTSL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSL Products
Required fields are marked with *
My Review for All CTSL Products
Required fields are marked with *