Recombinant Full Length Human Cutaneous T-Cell Lymphoma-Associated Antigen 1(Ctage1) Protein, His-Tagged
Cat.No. : | RFL22733HF |
Product Overview : | Recombinant Full Length Human Cutaneous T-cell lymphoma-associated antigen 1(CTAGE1) Protein (Q9HC47) (1-74aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-74) |
Form : | Lyophilized powder |
AA Sequence : | MFVIISLHNCVVISFVLFLFGGNNFIQNFYLPQNYIDQFLLTSFPTFTSVGVLIVLVLCS AFLLLWQGEGVNLR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CTAGE1 |
Synonyms | CTAGE1; CTAGE2; Cutaneous T-cell lymphoma-associated antigen 1; Protein cTAGE-1; Cancer/testis antigen 21.1; CT21.1 |
UniProt ID | Q9HC47 |
◆ Recombinant Proteins | ||
CTAGE1-2049H | Recombinant Human CTAGE1 Protein, GST-tagged | +Inquiry |
RFL23106HF | Recombinant Full Length Human Protein Ctage-2(Ctage1) Protein, His-Tagged | +Inquiry |
RFL22733HF | Recombinant Full Length Human Cutaneous T-Cell Lymphoma-Associated Antigen 1(Ctage1) Protein, His-Tagged | +Inquiry |
CTAGE1-11656H | Recombinant Human CTAGE1, His-tagged | +Inquiry |
CTAGE1-2258HF | Recombinant Full Length Human CTAGE1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTAGE1 Products
Required fields are marked with *
My Review for All CTAGE1 Products
Required fields are marked with *
0
Inquiry Basket