Recombinant Full Length Human CXCL10 Protein, C-Flag-tagged
Cat.No. : | CXCL10-583HFL |
Product Overview : | Recombinant Full Length Human CXCL10 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. This gene may also be a key regulator of the 'cytokine storm' immune response to SARS-CoV-2 infection. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 8.6 kDa |
AA Sequence : | MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways : | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Full Length : | Full L. |
Gene Name | CXCL10 C-X-C motif chemokine ligand 10 [ Homo sapiens (human) ] |
Official Symbol | CXCL10 |
Synonyms | C7; IFI10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10 |
Gene ID | 3627 |
mRNA Refseq | NM_001565.4 |
Protein Refseq | NP_001556.2 |
MIM | 147310 |
UniProt ID | P02778 |
◆ Recombinant Proteins | ||
CXCL10-70H | Recombinant Human CXCL10 (IP-10) | +Inquiry |
CXCL10-69F | Recombinant Feline CXCL10 (IP-10) | +Inquiry |
Cxcl10-175C | Active Recombinant Rat Cxcl10 Protein (77 aa) | +Inquiry |
Cxcl10-525M | Recombinant Mouse Cxcl10 Protein, His-tagged | +Inquiry |
CXCL10-938R | Recombinant Rat CXCL10 Protein (Ile22-Pro98), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL10-7172HCL | Recombinant Human CXCL10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL10 Products
Required fields are marked with *
My Review for All CXCL10 Products
Required fields are marked with *
0
Inquiry Basket