Recombinant Full Length Human CXCL10 Protein, GST-tagged

Cat.No. : CXCL10-2226HF
Product Overview : Human CXCL10 full-length ORF ( AAH10954, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 98 amino acids
Description : This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. [provided by RefSeq, Sep 2014]
Molecular Mass : 36.52 kDa
AA Sequence : MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CXCL10 chemokine (C-X-C motif) ligand 10 [ Homo sapiens ]
Official Symbol CXCL10
Synonyms CXCL10; chemokine (C-X-C motif) ligand 10; INP10, SCYB10, small inducible cytokine subfamily B (Cys X Cys), member 10; C-X-C motif chemokine 10; C7; crg 2; gIP 10; IFI10; IP 10; mob 1; gamma IP10; gamma-IP10; small-inducible cytokine B10; interferon-inducible cytokine IP-10; 10 kDa interferon gamma-induced protein; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10
Gene ID 3627
mRNA Refseq NM_001565
Protein Refseq NP_001556
MIM 147310
UniProt ID P02778

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL10 Products

Required fields are marked with *

My Review for All CXCL10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon