Recombinant Full Length Human CXCL11 Protein, GST-tagged
Cat.No. : | CXCL11-2278HF |
Product Overview : | Human CXCL11 full-length ORF ( AAH05292, 1 a.a. - 94 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 94 amino acids |
Description : | Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC. This antimicrobial gene is a CXC member of the chemokine superfamily. Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3. The gene encoding this protein contains 4 exons and at least three polyadenylation signals which might reflect cell-specific regulation of expression. IFN-gamma is a potent inducer of transcription of this gene. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2014] |
Molecular Mass : | 36.08 kDa |
AA Sequence : | MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CXCL11 chemokine (C-X-C motif) ligand 11 [ Homo sapiens ] |
Official Symbol | CXCL11 |
Synonyms | CXCL11; chemokine (C-X-C motif) ligand 11; SCYB9B, SCYB11, small inducible cytokine subfamily B (Cys X Cys), member 11; C-X-C motif chemokine 11; b R1; H174; I TAC; IP 9; beta-R1; small inducible cytokine B11; small-inducible cytokine B11; interferon gamma-inducible protein 9; interferon-inducible T-cell alpha chemoattractant; small inducible cytokine subfamily B (Cys-X-Cys), member 11; small inducible cytokine subfamily B (Cys-X-Cys), member 9B; IP9; IP-9; b-R1; I-TAC; SCYB11; SCYB9B; MGC102770; |
Gene ID | 6373 |
mRNA Refseq | NM_005409 |
Protein Refseq | NP_005400 |
MIM | 604852 |
UniProt ID | O14625 |
◆ Recombinant Proteins | ||
CXCL11-280H | Recombinant Human CXCL11 protein | +Inquiry |
CXCL11-106H | Human CXCL11, Biotin-tagged | +Inquiry |
CXCL11-167H | Active Recombinant Human Chemokine (C-X-C Motif) Ligand 11, MIgG2a Fc-tagged | +Inquiry |
CXCL11-2278HF | Recombinant Full Length Human CXCL11 Protein, GST-tagged | +Inquiry |
CXCL11-036H | Recombinant Human CXCL11 Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL11-7171HCL | Recombinant Human CXCL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCL11 Products
Required fields are marked with *
My Review for All CXCL11 Products
Required fields are marked with *
0
Inquiry Basket