Recombinant Full Length Human CXCL11 Protein, GST-tagged

Cat.No. : CXCL11-2278HF
Product Overview : Human CXCL11 full-length ORF ( AAH05292, 1 a.a. - 94 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 94 amino acids
Description : Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC. This antimicrobial gene is a CXC member of the chemokine superfamily. Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3. The gene encoding this protein contains 4 exons and at least three polyadenylation signals which might reflect cell-specific regulation of expression. IFN-gamma is a potent inducer of transcription of this gene. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2014]
Molecular Mass : 36.08 kDa
AA Sequence : MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CXCL11 chemokine (C-X-C motif) ligand 11 [ Homo sapiens ]
Official Symbol CXCL11
Synonyms CXCL11; chemokine (C-X-C motif) ligand 11; SCYB9B, SCYB11, small inducible cytokine subfamily B (Cys X Cys), member 11; C-X-C motif chemokine 11; b R1; H174; I TAC; IP 9; beta-R1; small inducible cytokine B11; small-inducible cytokine B11; interferon gamma-inducible protein 9; interferon-inducible T-cell alpha chemoattractant; small inducible cytokine subfamily B (Cys-X-Cys), member 11; small inducible cytokine subfamily B (Cys-X-Cys), member 9B; IP9; IP-9; b-R1; I-TAC; SCYB11; SCYB9B; MGC102770;
Gene ID 6373
mRNA Refseq NM_005409
Protein Refseq NP_005400
MIM 604852
UniProt ID O14625

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL11 Products

Required fields are marked with *

My Review for All CXCL11 Products

Required fields are marked with *

0
cart-icon
0
compare icon