Recombinant Full Length Human CXCL13 Protein, GST-tagged
| Cat.No. : | CXCL13-2284HF |
| Product Overview : | Human CXCL13 full-length ORF ( NP_006410.1, 1 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 109 amino acids |
| Description : | B lymphocyte chemoattractant, independently cloned and named Angie, is an antimicrobial peptide and CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches. It preferentially promotes the migration of B lymphocytes (compared to T cells and macrophages), apparently by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt's lymphoma receptor 1 (BLR-1). It may therefore function in the homing of B lymphocytes to follicles. [provided by RefSeq, Oct 2014] |
| Molecular Mass : | 39.1 kDa |
| AA Sequence : | MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CXCL13 chemokine (C-X-C motif) ligand 13 [ Homo sapiens ] |
| Official Symbol | CXCL13 |
| Synonyms | CXCL13; chemokine (C-X-C motif) ligand 13; SCYB13, small inducible cytokine B subfamily (Cys X Cys motif), member 13 (B cell chemoattractant); C-X-C motif chemokine 13; ANGIE; ANGIE2; B cell chemoattractant; BCA 1; BLC; BLR1L; CXC chemokine BLC; B-cell chemoattractant; B-lymphocyte chemoattractant; b lymphocyte chemoattractant; small-inducible cytokine B13; B-cell-attracting chemokine 1; b cell-attracting chemokine 1; chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant); B-cell-homing chemokine (ligand for Burkitts lymphoma receptor-1); small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant); BCA1; BCA-1; SCYB13 |
| Gene ID | 10563 |
| mRNA Refseq | NM_006419 |
| Protein Refseq | NP_006410 |
| MIM | 605149 |
| UniProt ID | O43927 |
| ◆ Recombinant Proteins | ||
| CXCL13-179C | Recombinant Cynomolgus Monkey CXCL13 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Cxcl13-7160M | Recombinant Mouse Cxcl13 protein, His & GST-tagged | +Inquiry |
| Cxcl13-79R | Recombinant Rat Cxcl13 Protein, His-GST-tagged | +Inquiry |
| CXCL13-124H | Active Recombinant Human Chemokine (C-X-C motif) Ligand 13, MIgG2a Fc-tagged | +Inquiry |
| CXCL13-132H | Active Recombinant Human CXCL13 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL13-7170HCL | Recombinant Human CXCL13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL13 Products
Required fields are marked with *
My Review for All CXCL13 Products
Required fields are marked with *
