Recombinant Full Length Human CXCL5 Protein, C-Flag-tagged
Cat.No. : | CXCL5-767HFL |
Product Overview : | Recombinant Full Length Human CXCL5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils, to promote angiogenesis and to remodel connective tissues. This protein is thought to play a role in cancer cell proliferation, migration, and invasion. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 8.3 kDa |
AA Sequence : | MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFA IGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKENTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Protein Pathways : | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Full Length : | Full L. |
Gene Name | CXCL5 C-X-C motif chemokine ligand 5 [ Homo sapiens (human) ] |
Official Symbol | CXCL5 |
Synonyms | SCYB5; ENA-78 |
Gene ID | 6374 |
mRNA Refseq | NM_002994.5 |
Protein Refseq | NP_002985.1 |
MIM | 600324 |
UniProt ID | P42830 |
◆ Recombinant Proteins | ||
CXCL5-1350R | Recombinant Rat CXCL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCL5-2772H | Recombinant Human CXCL5 protein, His-tagged | +Inquiry |
Cxcl5-97M | Recombinant Mouse Cxcl5 protein | +Inquiry |
CXCL5-234H | Recombinant Human X-C motif chemokine ligand 5 Protein, Tag Free | +Inquiry |
Cxcl5-98M | Recombinant Mouse Cxcl5 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL5-7167HCL | Recombinant Human CXCL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL5 Products
Required fields are marked with *
My Review for All CXCL5 Products
Required fields are marked with *
0
Inquiry Basket