Recombinant Full Length Human CXCL5 Protein, C-Flag-tagged

• Cat.No.: CXCL5-767HFL
• Product Overview: Recombinant Full Length Human CXCL5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils, to promote angiogenesis and to remodel connective tissues. This protein is thought to play a role in cancer cell proliferation, migration, and invasion.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 8.3 kDa
• AA Sequence: MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFA
  IGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKENTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction
• Full Length: Full L.

Gene Information

• Gene Name: CXCL5 C-X-C motif chemokine ligand 5 [ Homo sapiens (human) ]
• Official Symbol: CXCL5
• Synonyms: SCYB5; ENA-78
• Gene ID: 6374
• mRNA Refseq: NM_002994.5
• Protein Refseq: NP_002985.1
• MIM: 600324
• UniProt ID: P42830