Recombinant Full Length Human CXCL5 Protein, GST-tagged
Cat.No. : | CXCL5-2298HF |
Product Overview : | Human CXCL5 full-length ORF ( AAH08376, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 114 amino acids |
Description : | This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils, to promote angiogenesis and to remodel connective tissues. This protein is thought to play a role in cancer cell proliferation, migration, and invasion. [provided by RefSeq, May 2013] |
Molecular Mass : | 38.28 kDa |
AA Sequence : | MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLRKVIQKILDGGNKEN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CXCL5 chemokine (C-X-C motif) ligand 5 [ Homo sapiens ] |
Official Symbol | CXCL5 |
Synonyms | CXCL5; chemokine (C-X-C motif) ligand 5; SCYB5, small inducible cytokine subfamily B (Cys X Cys), member 5 (epithelial derived neutrophil activating peptide 78); C-X-C motif chemokine 5; ENA 78; ENA-78(1-78); small inducible cytokine B5; small-inducible cytokine B5; neutrophil-activating protein 78; neutrophil-activating peptide ENA-78; epithelial-derived neutrophil activating protein 78; epithelial-derived neutrophil-activating peptide 78; epithelial-derived neutrophil-activating protein 78; small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-derived neutrophil-activating peptide 78); SCYB5; ENA-78; |
Gene ID | 6374 |
mRNA Refseq | NM_002994 |
Protein Refseq | NP_002985 |
MIM | 600324 |
UniProt ID | P42830 |
◆ Recombinant Proteins | ||
CXCL5-2298HF | Recombinant Full Length Human CXCL5 Protein, GST-tagged | +Inquiry |
CXCL5-151H | Active Recombinant Human CXCL5 protein | +Inquiry |
CXCL5-131C | Active Recombinant Human CXCL5 Protein (74 aa) | +Inquiry |
CXCL5-190C | Active Recombinant Human CXCL5 Protein (78 aa) | +Inquiry |
Cxcl5-629R | Recombinant Rat Cxcl5 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL5-7167HCL | Recombinant Human CXCL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL5 Products
Required fields are marked with *
My Review for All CXCL5 Products
Required fields are marked with *