Recombinant Full Length Human CXorf40B Protein, GST-tagged
Cat.No. : | CXorf40B-2348HF |
Product Overview : | Human CXorf40B full-length ORF (AAH09523.1, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 158 amino acids |
Description : | CXorf40B (Chromosome X Open Reading Frame 40B) is a Protein Coding gene. An important paralog of this gene is CXorf40A. |
Molecular Mass : | 43.78 kDa |
AA Sequence : | MKFGCLSFRQPYAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWEGDACRELLVERLGMTPAQIQALLRKGEKFGRGVIAGLVDIGETLQCPEDLTPDEVVELENQAALTNLKQKYLTVISNPRWLLEPIPRKGGKDVFQVDIPEHLIPLGHEV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CXorf40B chromosome X open reading frame 40B [ Homo sapiens (human) ] |
Official Symbol | CXorf40B |
Synonyms | CXorf40B; chromosome X open reading frame 40B; Chromosome X Open Reading Frame 40B; protein CXorf40B |
Gene ID | 541578 |
mRNA Refseq | NM_001013845 |
Protein Refseq | NP_001013867 |
UniProt ID | Q96DE9 |
◆ Recombinant Proteins | ||
CXorf40B-2195H | Recombinant Human CXorf40B Protein, GST-tagged | +Inquiry |
CXorf40B-2348HF | Recombinant Full Length Human CXorf40B Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXorf40B-210HCL | Recombinant Human CXorf40B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXorf40B Products
Required fields are marked with *
My Review for All CXorf40B Products
Required fields are marked with *
0
Inquiry Basket