Recombinant Full Length Human CYB5R1 Protein, GST-tagged
Cat.No. : | CYB5R1-2383HF |
Product Overview : | Human CYB5R1 full-length ORF ( NP_057327.2, 1 a.a. - 305 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 305 amino acids |
Description : | CYB5R1 (Cytochrome B5 Reductase 1) is a Protein Coding gene. Among its related pathways are Response to elevated platelet cytosolic Ca2+ and Erythrocytes take up carbon dioxide and release oxygen. GO annotations related to this gene include oxidoreductase activity and cytochrome-b5 reductase activity, acting on NAD(P)H. An important paralog of this gene is CYB5R3. |
Molecular Mass : | 60.5 kDa |
AA Sequence : | MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CYB5R1 cytochrome b5 reductase 1 [ Homo sapiens ] |
Official Symbol | CYB5R1 |
Synonyms | CYB5R1; cytochrome b5 reductase 1; NAD(P)H:quinone oxidoreductase type 3, polypeptide A2 , NQO3A2; NADH-cytochrome b5 reductase 1; humb5R2; NAD(P)H:quinone oxidoreductase type 3 polypeptide A2; NAD(P)H:quinone oxidoreductase type 3, polypeptide A2; B5R1; B5R.1; NQO3A2; |
Gene ID | 51706 |
mRNA Refseq | NM_016243 |
Protein Refseq | NP_057327 |
MIM | 608341 |
UniProt ID | Q9UHQ9 |
◆ Recombinant Proteins | ||
CYB5R1-2215H | Recombinant Human CYB5R1 Protein, GST-tagged | +Inquiry |
CYB5R1-2383HF | Recombinant Full Length Human CYB5R1 Protein, GST-tagged | +Inquiry |
CYB5R1-1703R | Recombinant Rat CYB5R1 Protein | +Inquiry |
CYB5R1-10535Z | Recombinant Zebrafish CYB5R1 | +Inquiry |
CYB5R1-1126R | Recombinant Rhesus monkey CYB5R1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYB5R1-7144HCL | Recombinant Human CYB5R1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYB5R1 Products
Required fields are marked with *
My Review for All CYB5R1 Products
Required fields are marked with *