Recombinant Full Length Human CYCS Protein, GST-tagged
Cat.No. : | CYCS-2400HF |
Product Overview : | Human CYCS full-length ORF ( AAH05299, 1 a.a. - 105 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 105 amino acids |
Description : | This gene encodes a small heme protein that functions as a central component of the electron transport chain in mitochondria. The encoded protein associates with the inner membrane of the mitochondrion where it accepts electrons from cytochrome b and transfers them to the cytochrome oxidase complex. This protein is also involved in initiation of apoptosis. Mutations in this gene are associated with autosomal dominant nonsyndromic thrombocytopenia. Numerous processed pseudogenes of this gene are found throughout the human genome.[provided by RefSeq, Jul 2010] |
Molecular Mass : | 37.29 kDa |
AA Sequence : | MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CYCS cytochrome c, somatic [ Homo sapiens ] |
Official Symbol | CYCS |
Synonyms | CYCS; cytochrome c, somatic; cytochrome c; HCS; CYC; THC4; |
Gene ID | 54205 |
mRNA Refseq | NM_018947 |
Protein Refseq | NP_061820 |
MIM | 123970 |
UniProt ID | P99999 |
◆ Recombinant Proteins | ||
CYCS-193H | Recombinant Human CYCS | +Inquiry |
CYCS-2400HF | Recombinant Full Length Human CYCS Protein, GST-tagged | +Inquiry |
CYCS-2764H | Recombinant Human CYCS Protein, His (Fc)-Avi-tagged | +Inquiry |
CYCS-3137H | Recombinant Human CYCS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CYCS-1709R | Recombinant Rat CYCS Protein | +Inquiry |
◆ Native Proteins | ||
CYCS-17B | Native Bovine Cytochrome C Protein | +Inquiry |
CYTC-168E | Native Horse Cytochrome C | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYCS-7135HCL | Recombinant Human CYCS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYCS Products
Required fields are marked with *
My Review for All CYCS Products
Required fields are marked with *