Recombinant Full Length Human CYGB Protein, GST-tagged
| Cat.No. : | CYGB-2271HF |
| Product Overview : | Human CYGB full-length ORF ( AAH29798, 1 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 190 amino acids |
| Description : | This gene encodes a globin protein found in vertebrate cells. The encoded protein is described as a hexacoordinate hemoglobin which binds ligand differently from the pentacoordinate hemoglobins involved in oxygen transport, and may be involved in protection during oxidative stress. This gene is located on chromosome 17 in the same region as a retinal gene which is mutated in progressive rod-cone degeneration, but in the opposite orientation. [provided by RefSeq, Jan 2012] |
| Molecular Mass : | 46.64 kDa |
| AA Sequence : | MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CYGB cytoglobin [ Homo sapiens ] |
| Official Symbol | CYGB |
| Synonyms | CYGB; cytoglobin; HGB; histoglobin; STAP; stellate cell activation associated protein; stellate cell activation-associated protein |
| Gene ID | 114757 |
| mRNA Refseq | NM_134268 |
| Protein Refseq | NP_599030 |
| MIM | 608759 |
| UniProt ID | Q8WWM9 |
| ◆ Recombinant Proteins | ||
| CYGB-669H | Recombinant Human CYGB Protein, His-tagged | +Inquiry |
| CYGB-1370R | Recombinant Rat CYGB Protein, His (Fc)-Avi-tagged | +Inquiry |
| CYGB-1731H | Recombinant Human CYGB Protein (Met1-Pro190), C-His tagged | +Inquiry |
| CYGB-26694TH | Recombinant Human CYGB, His-tagged | +Inquiry |
| Cygb-670R | Recombinant Rat Cygb Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CYGB-7134HCL | Recombinant Human CYGB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYGB Products
Required fields are marked with *
My Review for All CYGB Products
Required fields are marked with *
