Recombinant Full Length Human CYP11B1 Protein, GST-tagged
Cat.No. : | CYP11B1-2292HF |
Product Overview : | Human CYP11B1 full-length ORF ( AAH96285.1, 1 a.a. - 574 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 574 amino acids |
Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and is involved in the conversion of progesterone to cortisol in the adrenal cortex. Mutations in this gene cause congenital adrenal hyperplasia due to 11-beta-hydroxylase deficiency. Transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 91.5 kDa |
AA Sequence : | MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRSRHSASFGRWGRSAARAGLWRCQGRGWCRANPSSLQRGQDSEALKYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNVADRGNSSPPFPGGIHGAPTHSGCRNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CYP11B1 cytochrome P450, family 11, subfamily B, polypeptide 1 [ Homo sapiens ] |
Official Symbol | CYP11B1 |
Synonyms | CYP11B1; cytochrome P450, family 11, subfamily B, polypeptide 1; CYP11B, cytochrome P450, subfamily XIB (steroid 11 beta hydroxylase), polypeptide 1; cytochrome P450 11B1, mitochondrial; CPN1; FHI; P450C11; CYPXIB1; cytochrome P450C11; cytochrome P-450c11; cytochrome p450 XIB1; steroid 11-beta-hydroxylase; steroid 11-beta-monooxygenase; cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 1; CYP11B; FLJ36771; DKFZp686B05283 |
Gene ID | 1584 |
mRNA Refseq | NM_000497 |
Protein Refseq | NP_000488 |
MIM | 610613 |
UniProt ID | P15538 |
◆ Recombinant Proteins | ||
CYP11B1-2240H | Recombinant Human CYP11B1 Protein, GST-tagged | +Inquiry |
Cyp11b1-8080R | Recombinant Rat Cyp11b1 protein, His & T7-tagged | +Inquiry |
CYP11B1-1133R | Recombinant Rhesus monkey CYP11B1 Protein, His-tagged | +Inquiry |
CYP11B1-2396H | Recombinant Human CYP11B1 Protein (25-503 aa), His-SUMO-Myc-tagged | +Inquiry |
Cyp11b1-889M | Recombinant Mouse Cyp11b1 Protein, His&SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP11B1-7130HCL | Recombinant Human CYP11B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP11B1 Products
Required fields are marked with *
My Review for All CYP11B1 Products
Required fields are marked with *
0
Inquiry Basket