Recombinant Full Length Human CYP19A1 Protein
Cat.No. : | CYP19A1-112HF |
Product Overview : | Recombinant full length Human Aromatase with a N terminal proprietary tag: predicted molecular weight 49.98 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and catalyzes the last steps of estrogen biosynthesis, three successive hydroxylations of the A ring of androgens. Mutations in this gene can result in either increased or decreased aromatase activity; the associated phenotypes suggest that estrogen functions both as a sex steroid hormone and in growth or differentiation. The gene expresses two transcript variants. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 49.980kDa inclusive of tags |
Protein Length : | 219 amino acids |
AA Sequence : | MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWN YEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRV YGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL GLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRM VTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSN TLFLRIPLDGTEIFTLTS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | CYP19A1 cytochrome P450, family 19, subfamily A, polypeptide 1 [ Homo sapiens ] |
Official Symbol : | CYP19A1 |
Synonyms : | CYP19A1; cytochrome P450, family 19, subfamily A, polypeptide 1; CYP19, cytochrome P450, subfamily XIX (aromatization of androgens); cytochrome P450 19A1; ARO; ARO1; aromatase; CPV1; CYAR; P 450AROM |
Gene ID : | 1588 |
mRNA Refseq : | NM_000103 |
Protein Refseq : | NP_000094 |
MIM : | 107910 |
UniProt ID : | P11511 |
Products Types
◆ Recombinant Protein | ||
CYP19A1-698H | Recombinant Human CYP19A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYP19A1-2126M | Recombinant Mouse CYP19A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cyp19a1-369R | Recombinant Rat Cyp19a1 Protein, His-tagged | +Inquiry |
CYP19A1-548H | Recombinant Human CYP19A1 Protein, His-tagged | +Inquiry |
Cyp19a1-2411M | Recombinant Mouse Cyp19a1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Lysates | ||
CYP19A1-7127HCL | Recombinant Human CYP19A1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket