Recombinant Full Length Human CYP19A1 Protein

Cat.No. : CYP19A1-112HF
Product Overview : Recombinant full length Human Aromatase with a N terminal proprietary tag: predicted molecular weight 49.98 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 219 amino acids
Description : This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and catalyzes the last steps of estrogen biosynthesis, three successive hydroxylations of the A ring of androgens. Mutations in this gene can result in either increased or decreased aromatase activity; the associated phenotypes suggest that estrogen functions both as a sex steroid hormone and in growth or differentiation. The gene expresses two transcript variants.
Form : Liquid
Molecular Mass : 49.980kDa inclusive of tags
AA Sequence : MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWN YEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRV YGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL GLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRM VTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSN TLFLRIPLDGTEIFTLTS
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name CYP19A1 cytochrome P450, family 19, subfamily A, polypeptide 1 [ Homo sapiens ]
Official Symbol CYP19A1
Synonyms CYP19A1; cytochrome P450, family 19, subfamily A, polypeptide 1; CYP19, cytochrome P450, subfamily XIX (aromatization of androgens); cytochrome P450 19A1; ARO; ARO1; aromatase; CPV1; CYAR; P 450AROM
Gene ID 1588
mRNA Refseq NM_000103
Protein Refseq NP_000094
MIM 107910
UniProt ID P11511

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYP19A1 Products

Required fields are marked with *

My Review for All CYP19A1 Products

Required fields are marked with *

0
cart-icon