Recombinant Full Length Human CYP21A2 Protein, C-Flag-tagged
Cat.No. : | CYP21A2-24HFL |
Product Overview : | Recombinant Full Length Human CYP21A2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and hydroxylates steroids at the 21 position. Its activity is required for the synthesis of steroid hormones including cortisol and aldosterone. Mutations in this gene cause congenital adrenal hyperplasia. A related pseudogene is located near this gene; gene conversion events involving the functional gene and the pseudogene are thought to account for many cases of steroid 21-hydroxylase deficiency. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55.8 kDa |
AA Sequence : | MLLLGLLLLLPLLAGARLLWNWWKLQSLHLPPLAPGFLHLLQPDLPIYLLGLTQKFGPIYRLHLGLQDVV VLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSRNYPDLSLGDYSLLWKAHKKLTRSALLLGIRDSMEPVV EQLTQEFCERMRAQPGTPVAIEEEFSLLTCSIICYLTFGDKIKDDNLMPAYYKCIQEVLKTWSHWSIQIV DVIPFLRFFPNPGLRRLKQAIEKRDHIVEMQLRQHKESLVAGQWRDMMDYMLQGVAQPSMEEGSGQLLEG HVHMAAVDLLIGGTETTANTLSWAVVFLLHHPEIQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATI AEVLRLRPVVPLALPHRTTRPSSISGYDIPEGTVIIPNLQGAHLDETVWERPHEFWPDRFLEPGKNSRAL AFGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRLQPRGMGAHS PGQSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, P450 |
Protein Pathways : | C21-Steroid hormone metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | CYP21A2 cytochrome P450 family 21 subfamily A member 2 [ Homo sapiens (human) ] |
Official Symbol | CYP21A2 |
Synonyms | CAH1; CPS1; CA21H; CYP21; CYP21B; P450c21B |
Gene ID | 1589 |
mRNA Refseq | NM_000500.9 |
Protein Refseq | NP_000491.4 |
MIM | 613815 |
UniProt ID | P08686 |
◆ Recombinant Proteins | ||
CYP21A2-606H | Recombinant Human CYP21A2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CYP21A2-1139R | Recombinant Rhesus monkey CYP21A2 Protein, His-tagged | +Inquiry |
CYP21A2-699H | Recombinant Human CYP21A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYP21A2-1180H | Recombinant Human CYP21A2 Protein, His-tagged | +Inquiry |
CYP21A2-447H | Recombinant Human CYP21A2 Protein (1-494 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP21A2-7123HCL | Recombinant Human CYP21A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP21A2 Products
Required fields are marked with *
My Review for All CYP21A2 Products
Required fields are marked with *
0
Inquiry Basket