Recombinant Full Length Human CYP3A5 Protein
Cat.No. : | CYP3A5-118HF |
Product Overview : | Recombinant full length Human Cytochrome P450 3A5 with N terminal proprietary tag; Predicted MWt 80.96 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 502 amino acids |
Description : | This gene,CYP3A5, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. The enzyme metabolizes drugs such as nifedipine and cyclosporine as well as the steroid hormones testosterone, progesterone and androstenedione. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. This cluster includes a pseudogene, CYP3A5P1, which is very similar to CYP3A5. This similarity has caused some difficulty in determining whether cloned sequences represent the gene or the pseudogene. Multiple alternatively spliced transcript variants have been identified for this gene. |
Form : | Liquid |
Molecular Mass : | 80.960kDa inclusive of tags |
AA Sequence : | MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPG PTPLPLLGNVLSYRQGLWKFDTECYKKYGKMWGTYEGQLP VLAITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISL AEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNL RREAEKGKPVTLKDIFGAYSMDVITGTSFGVNIDSLNNPQ DPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEALNVSL FPKDTINFLSKSVNRMKKSRLNDKQKHRLDFLQLMIDSQN SKETESHKALSDLELAAQSIIFIFAGYETTSSVLSFTLYE LATHPDVQQKLQKEIDAVLPNKAPPTYDAVVQMEYLDMVV NETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYA LHHDPKYWTEPEEFRPERFSKKKDSIDPYIYTPFGTGPRN CIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQG LLQPEKPIVLKVDSRDGTLSGE |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CYP3A5 cytochrome P450, family 3, subfamily A, polypeptide 5 [ Homo sapiens ] |
Official Symbol | CYP3A5 |
Synonyms | CYP3A5; cytochrome P450, family 3, subfamily A, polypeptide 5; cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 5; cytochrome P450 3A5; CP35; P450PCN3; PCN3 |
Gene ID | 1577 |
mRNA Refseq | NM_000777 |
Protein Refseq | NP_000768 |
MIM | 605325 |
UniProt ID | P20815 |
◆ Recombinant Proteins | ||
CYP3A5-2438HF | Recombinant Full Length Human CYP3A5 Protein, GST-tagged | +Inquiry |
CYP3A5-82H | Active Recombinant Human CYP3A5 Protein | +Inquiry |
CYP3A5-985R | Recombinant Rhesus Macaque CYP3A5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYP3A5-69H | Active Recombinant Human CYP3A5 Protein | +Inquiry |
CYP3A5-2276H | Recombinant Human CYP3A5 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP3A5-7106HCL | Recombinant Human CYP3A5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP3A5 Products
Required fields are marked with *
My Review for All CYP3A5 Products
Required fields are marked with *
0
Inquiry Basket