Recombinant Full Length Human CYP7A1 Protein, C-Flag-tagged
Cat.No. : | CYP7A1-552HFL |
Product Overview : | Recombinant Full Length Human CYP7A1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway in the liver, which converts cholesterol to bile acids. This reaction is the rate limiting step and the major site of regulation of bile acid synthesis, which is the primary mechanism for the removal of cholesterol from the body. Polymorphisms in the promoter of this gene are associated with defects in bile acid synthesis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 57.5 kDa |
AA Sequence : | MMTTSLIWGIAIAACCCLWLILGIRRRQTGEPPLENGLIPYLGCALQFGANPLEFLRANQRKHGHVFTCK LMGKYVHFITNPLSYHKVLCHGKYFDWKKFHFATSAKAFGHRSIDPMDGNTTENINDTFIKTLQGHALNS LTESMMENLQRIMRPPVSSNSKTAAWVTEGMYSFCYRVMFEAGYLTIFGRDLTRRDTQKAHILNNLDNFK QFDKVFPALVAGLPIHMFRTAHNAREKLAESLRHENLQKRESISELISLRMFLNDTLSTFDDLEKAKTHL VVLWASQANTIPATFWSLFQMIRNPEAMKAATEEVKRTLENAGQKVSLEGNPICLSQAELNDLPVLDSII KESLRLSSASLNIRTAKEDFTLHLEDGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTK TTFYCNGLKLKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQAKCPPLDQSRAGLGILP PLNDIEFKYKFKHLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, P450, Transmembrane |
Protein Pathways : | Metabolic pathways, PPAR signaling pathway, Primary bile acid biosynthesis |
Full Length : | Full L. |
Gene Name | CYP7A1 cytochrome P450 family 7 subfamily A member 1 [ Homo sapiens (human) ] |
Official Symbol | CYP7A1 |
Synonyms | CP7A; CYP7; CYPVII |
Gene ID | 1581 |
mRNA Refseq | NM_000780.4 |
Protein Refseq | NP_000771.2 |
MIM | 118455 |
UniProt ID | P22680 |
◆ Recombinant Proteins | ||
CYP7A1-708H | Recombinant Human CYP7A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cyp7a1-1441R | Recombinant Rat Cyp7a1 protein, His & T7-tagged | +Inquiry |
CYP7A1-1149C | Recombinant Chicken CYP7A1 | +Inquiry |
CYP7A1-2291H | Recombinant Human CYP7A1 Protein, GST-tagged | +Inquiry |
CYP7A1-2425H | Recombinant Human CYP7A1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP7A1-7099HCL | Recombinant Human CYP7A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP7A1 Products
Required fields are marked with *
My Review for All CYP7A1 Products
Required fields are marked with *
0
Inquiry Basket