Recombinant Full Length Human CYSRT1 Protein, C-Flag-tagged
| Cat.No. : | CYSRT1-1777HFL |
| Product Overview : | Recombinant Full Length Human CYSRT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Enables identical protein binding activity. Located in extracellular exosome. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 15.1 kDa |
| AA Sequence : | MDPQEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAK GNQGAAPIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPVGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCC CVIS myc-FLAG tag |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | CYSRT1 cysteine rich tail 1 [ Homo sapiens (human) ] |
| Official Symbol | CYSRT1 |
| Synonyms | C9orf169 |
| Gene ID | 375791 |
| mRNA Refseq | NM_199001.5 |
| Protein Refseq | NP_945352.4 |
| UniProt ID | A8MQ03 |
| ◆ Recombinant Proteins | ||
| CYSRT1-6014H | Recombinant Human CYSRT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CYSRT1-3398H | Recombinant Human CYSRT1 Protein, MYC/DDK-tagged | +Inquiry |
| Cysrt1-2427M | Recombinant Mouse Cysrt1 Protein, Myc/DDK-tagged | +Inquiry |
| CYSRT1-709H | Recombinant Human CYSRT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CYSRT1-2275H | Recombinant Human CYSRT1 Protein (1-184 aa), His-B2M-JD-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYSRT1 Products
Required fields are marked with *
My Review for All CYSRT1 Products
Required fields are marked with *
