Recombinant Human CYSRT1 Protein (1-184 aa), His-B2M-JD-tagged

Cat.No. : CYSRT1-2275H
Product Overview : Recombinant Human CYSRT1 Protein (1-184 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-B2M-JD tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : B2M&His
Protein Length : 1-184 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 25.2 kDa
AA Sequence : MAPPLPRREKAAASRSTQALGPRAQKTERTDCRVATTGWTMDPQEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAKGNQGAAPIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPAGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCCCVIS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name CYSRT1 cysteine rich tail 1 [ Homo sapiens (human) ]
Official Symbol CYSRT1
Synonyms CYSRT1; C9orf169;
Gene ID 375791
UniProt ID B8A4K4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYSRT1 Products

Required fields are marked with *

My Review for All CYSRT1 Products

Required fields are marked with *

0
cart-icon
0
compare icon