Recombinant Human CYSRT1 Protein (1-184 aa), His-B2M-JD-tagged

• Cat.No.: CYSRT1-2275H
• Product Overview: Recombinant Human CYSRT1 Protein (1-184 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-B2M-JD tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: B2M&His
• Protein Length: 1-184 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 25.2 kDa
• AA Sequence: MAPPLPRREKAAASRSTQALGPRAQKTERTDCRVATTGWTMDPQEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAKGNQGAAPIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPAGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCCCVIS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: CYSRT1 cysteine rich tail 1 [ Homo sapiens (human) ]
• Official Symbol: CYSRT1
• Synonyms: CYSRT1; C9orf169
• Gene ID: 375791
• UniProt ID: B8A4K4