Recombinant Human CYSRT1 Protein (1-184 aa), His-B2M-JD-tagged
Cat.No. : | CYSRT1-2275H |
Product Overview : | Recombinant Human CYSRT1 Protein (1-184 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-B2M-JD tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | B2M&His |
Protein Length : | 1-184 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 25.2 kDa |
AA Sequence : | MAPPLPRREKAAASRSTQALGPRAQKTERTDCRVATTGWTMDPQEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAKGNQGAAPIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPAGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCCCVIS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | CYSRT1 cysteine rich tail 1 [ Homo sapiens (human) ] |
Official Symbol | CYSRT1 |
Synonyms | CYSRT1; C9orf169; |
Gene ID | 375791 |
UniProt ID | B8A4K4 |
◆ Recombinant Proteins | ||
CYSRT1-6014H | Recombinant Human CYSRT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Cysrt1-2427M | Recombinant Mouse Cysrt1 Protein, Myc/DDK-tagged | +Inquiry |
CYSRT1-3398H | Recombinant Human CYSRT1 Protein, MYC/DDK-tagged | +Inquiry |
CYSRT1-709H | Recombinant Human CYSRT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYSRT1-1777HFL | Recombinant Full Length Human CYSRT1 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYSRT1 Products
Required fields are marked with *
My Review for All CYSRT1 Products
Required fields are marked with *