Recombinant Full Length Human Cysteine-Rich With Egf-Like Domain Protein 1(Creld1) Protein, His-Tagged
Cat.No. : | RFL32610HF |
Product Overview : | Recombinant Full Length Human Cysteine-rich with EGF-like domain protein 1(CRELD1) Protein (Q96HD1) (30-420aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (30-420) |
Form : | Lyophilized powder |
AA Sequence : | QPSPPPQSSPPPQPHPCHTCRGLVDSFNKGLERTIRDNFGGGNTAWEEENLSKYKDSETR LVEVLEGVCSKSDFECHRLLELSEELVESWWFHKQQEAPDLFQWLCSDSLKLCCPAGTFG PSCLPCPGGTERPCGGYGQCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNASHL VCSACFGPCARCSGPEESNCLQCKKGWALHHLKCVDIDECGTEGANCGADQFCVNTEGSY ECRDCAKACLGCMGAGPGRCKKCSPGYQQVGSKCLDVDECETEVCPGENKQCENTEGGYR CICAEGYKQMEGICVKEQIPESAGFFSEMTEDELVVLQQMFFGIIICALATLAAKGDLVF TAIFIGAVAAMTGYWLSERSDRVLEGFIKGR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CRELD1 |
Synonyms | CRELD1; CIRRIN; UNQ188/PRO214; Protein disulfide isomerase CRELD1; Cysteine-rich with EGF-like domain protein 1 |
UniProt ID | Q96HD1 |
◆ Recombinant Proteins | ||
RFL10266RF | Recombinant Full Length Rat Cysteine-Rich With Egf-Like Domain Protein 1(Creld1) Protein, His-Tagged | +Inquiry |
CRELD1-3328H | Recombinant Human CRELD1 Protein, MYC/DDK-tagged | +Inquiry |
RFL32610HF | Recombinant Full Length Human Cysteine-Rich With Egf-Like Domain Protein 1(Creld1) Protein, His-Tagged | +Inquiry |
Creld1-2308M | Recombinant Mouse Creld1 Protein, Myc/DDK-tagged | +Inquiry |
CRELD1-1594R | Recombinant Rat CRELD1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRELD1-1250HCL | Recombinant Human CRELD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRELD1 Products
Required fields are marked with *
My Review for All CRELD1 Products
Required fields are marked with *