Recombinant Full Length Human Cytotoxic T-Lymphocyte Protein 4(Ctla4) Protein, His-Tagged
Cat.No. : | RFL18315HF |
Product Overview : | Recombinant Full Length Human Cytotoxic T-lymphocyte protein 4(CTLA4) Protein (P16410) (36-223aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (36-223) |
Form : | Lyophilized powder |
AA Sequence : | KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CTLA4 |
Synonyms | CTLA4; CD152; Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD antigen CD152 |
UniProt ID | P16410 |
◆ Recombinant Proteins | ||
Ctla4-3261MAF555 | Recombinant Mouse Ctla4 Protein, hFc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
CTLA4-653M | Recombinant Mouse CTLA4 Protein | +Inquiry |
CTLA4-371H | Recombinant Human CTLA4 protein, mouse IgG2a Fc-tagged, low endotoxin | +Inquiry |
Ctla4-1144R | Recombinant Rat Ctla4 Protein, His-tagged | +Inquiry |
CTLA4-8852C | Active Recombinant Cynomolgus CTLA4 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTLA4-2179MCL | Recombinant Mouse CTLA4 cell lysate | +Inquiry |
CTLA4-1047CCL | Recombinant Cynomolgus CTLA4 cell lysate | +Inquiry |
CTLA4-2526HCL | Recombinant Human CTLA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTLA4 Products
Required fields are marked with *
My Review for All CTLA4 Products
Required fields are marked with *
0
Inquiry Basket