Recombinant Full Length Human DBI Protein, C-Flag-tagged
Cat.No. : | DBI-1107HFL |
Product Overview : | Recombinant Full Length Human DBI Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 11.6 kDa |
AA Sequence : | MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGK AKWDAWNELKGTSKEDAMKAYINKVEELKKKYGITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | PPAR signaling pathway |
Full Length : | Full L. |
Gene Name | DBI diazepam binding inhibitor, acyl-CoA binding protein [ Homo sapiens (human) ] |
Official Symbol | DBI |
Synonyms | EP; ACBP; ACBD1; CCK-RP |
Gene ID | 1622 |
mRNA Refseq | NM_020548.9 |
Protein Refseq | NP_065438.1 |
MIM | 125950 |
UniProt ID | P07108 |
◆ Recombinant Proteins | ||
Dbi-688M | Recombinant Mouse Dbi protein, His&Myc-tagged | +Inquiry |
DBI-1779R | Recombinant Rat DBI Protein | +Inquiry |
DBI-1925H | Recombinant Human DBI Protein (Ala4-Ile87), N-GST tagged | +Inquiry |
DBI-1232H | Recombinant Human DBI protein(Met1-Ala87), His-tagged | +Inquiry |
DBI-28330TH | Recombinant Human DBI | +Inquiry |
◆ Cell & Tissue Lysates | ||
DBI-7066HCL | Recombinant Human DBI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DBI Products
Required fields are marked with *
My Review for All DBI Products
Required fields are marked with *
0
Inquiry Basket