Recombinant Mouse Dbi protein, His&Myc-tagged
| Cat.No. : | Dbi-688M |
| Product Overview : | Recombinant Mouse Dbi protein(P31786)(1-87aa(K33A)), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-87aa(K33A) |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 17.4 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MSQAEFDKAAEEVKRLKTQPTDEEMLFIYSHFAQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESAMKTYVEKVDELKKKYGI |
| Gene Name | Dbi diazepam binding inhibitor [ Mus musculus ] |
| Official Symbol | Dbi |
| Synonyms | DBI; diazepam binding inhibitor; acyl-CoA-binding protein; acyl-CoA binding protein; diazepam-binding inhibitor; diazepam binding inhibitor, splice form 1b; EP; Acbp; ACBD1; endozepine; |
| Gene ID | 13167 |
| mRNA Refseq | NM_001037999 |
| Protein Refseq | NP_001033088 |
| ◆ Recombinant Proteins | ||
| Dbi-3133R | Recombinant Rat Dbi, GST-tagged | +Inquiry |
| DBI-2566HF | Recombinant Full Length Human DBI Protein, GST-tagged | +Inquiry |
| DBI-1232H | Recombinant Human DBI protein(Met1-Ala87), His-tagged | +Inquiry |
| DBI-26687TH | Recombinant Human DBI, His-tagged | +Inquiry |
| Dbi-688M | Recombinant Mouse Dbi protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DBI-7066HCL | Recombinant Human DBI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Dbi Products
Required fields are marked with *
My Review for All Dbi Products
Required fields are marked with *



