Recombinant Full Length Human DBNDD1 Protein, GST-tagged
| Cat.No. : | DBNDD1-6180HF |
| Product Overview : | Human MGC3101 full-length ORF ( ENSP00000306407, 1 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 156 amino acids |
| Description : | DBNDD1 (Dysbindin Domain Containing 1) is a Protein Coding gene. |
| Molecular Mass : | 43.3 kDa |
| AA Sequence : | MAGLPIPPEIVKEAEVPQAALGVPAQGTGDNGHTPVEEEVGGIPVPAPGLLQVTERRQPLSSVSSLEVHFDLLDLTELTDMSDQELAEVFADSDDENLNTESPAGLHPLPRAGYLRSPSWTRTRAEQSHEKQPLGDPERQATVLDTFLTVERPQED |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DBNDD1 dysbindin (dystrobrevin binding protein 1) domain containing 1 [ Homo sapiens ] |
| Official Symbol | DBNDD1 |
| Synonyms | DBNDD1; dysbindin (dystrobrevin binding protein 1) domain containing 1 |
| Gene ID | 79007 |
| mRNA Refseq | NM_024043 |
| Protein Refseq | NP_076948 |
| UniProt ID | Q9H9R9 |
| ◆ Recombinant Proteins | ||
| DBNDD1-6955H | Recombinant Human dysbindin (dystrobrevin binding protein 1) domain containing 1, His-tagged | +Inquiry |
| DBNDD1-1440R | Recombinant Rat DBNDD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DBNDD1-1782R | Recombinant Rat DBNDD1 Protein | +Inquiry |
| DBNDD1-6492H | Recombinant Human DBNDD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Dbndd1-2463M | Recombinant Mouse Dbndd1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DBNDD1-7065HCL | Recombinant Human DBNDD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DBNDD1 Products
Required fields are marked with *
My Review for All DBNDD1 Products
Required fields are marked with *
