Recombinant Full Length Human DBNDD1 Protein, GST-tagged
| Cat.No. : | DBNDD1-6180HF | 
| Product Overview : | Human MGC3101 full-length ORF ( ENSP00000306407, 1 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 156 amino acids | 
| Description : | DBNDD1 (Dysbindin Domain Containing 1) is a Protein Coding gene. | 
| Molecular Mass : | 43.3 kDa | 
| AA Sequence : | MAGLPIPPEIVKEAEVPQAALGVPAQGTGDNGHTPVEEEVGGIPVPAPGLLQVTERRQPLSSVSSLEVHFDLLDLTELTDMSDQELAEVFADSDDENLNTESPAGLHPLPRAGYLRSPSWTRTRAEQSHEKQPLGDPERQATVLDTFLTVERPQED | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | DBNDD1 dysbindin (dystrobrevin binding protein 1) domain containing 1 [ Homo sapiens ] | 
| Official Symbol | DBNDD1 | 
| Synonyms | DBNDD1; dysbindin (dystrobrevin binding protein 1) domain containing 1 | 
| Gene ID | 79007 | 
| mRNA Refseq | NM_024043 | 
| Protein Refseq | NP_076948 | 
| UniProt ID | Q9H9R9 | 
| ◆ Recombinant Proteins | ||
| DBNDD1-1179R | Recombinant Rhesus monkey DBNDD1 Protein, His-tagged | +Inquiry | 
| DBNDD1-6492H | Recombinant Human DBNDD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| DBNDD1-6180HF | Recombinant Full Length Human DBNDD1 Protein, GST-tagged | +Inquiry | 
| DBNDD1-1004R | Recombinant Rhesus Macaque DBNDD1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| DBNDD1-1782R | Recombinant Rat DBNDD1 Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| DBNDD1-7065HCL | Recombinant Human DBNDD1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DBNDD1 Products
Required fields are marked with *
My Review for All DBNDD1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            