Recombinant Human DBNDD1 Protein, GST-tagged

Cat.No. : DBNDD1-4329H
Product Overview : Human MGC3101 full-length ORF ( ENSP00000306407, 1 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DBNDD1 (Dysbindin Domain Containing 1) is a Protein Coding gene.
Molecular Mass : 43.3 kDa
AA Sequence : MAGLPIPPEIVKEAEVPQAALGVPAQGTGDNGHTPVEEEVGGIPVPAPGLLQVTERRQPLSSVSSLEVHFDLLDLTELTDMSDQELAEVFADSDDENLNTESPAGLHPLPRAGYLRSPSWTRTRAEQSHEKQPLGDPERQATVLDTFLTVERPQED
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DBNDD1 dysbindin (dystrobrevin binding protein 1) domain containing 1 [ Homo sapiens ]
Official Symbol DBNDD1
Synonyms DBNDD1; dysbindin (dystrobrevin binding protein 1) domain containing 1
Gene ID 79007
mRNA Refseq NM_024043
Protein Refseq NP_076948
UniProt ID Q9H9R9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DBNDD1 Products

Required fields are marked with *

My Review for All DBNDD1 Products

Required fields are marked with *

0
cart-icon