Recombinant Human DBNDD1 Protein, GST-tagged

• Cat.No.: DBNDD1-4329H
• Product Overview: Human MGC3101 full-length ORF ( ENSP00000306407, 1 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: DBNDD1 (Dysbindin Domain Containing 1) is a Protein Coding gene.
• Molecular Mass: 43.3 kDa
• AA Sequence: MAGLPIPPEIVKEAEVPQAALGVPAQGTGDNGHTPVEEEVGGIPVPAPGLLQVTERRQPLSSVSSLEVHFDLLDLTELTDMSDQELAEVFADSDDENLNTESPAGLHPLPRAGYLRSPSWTRTRAEQSHEKQPLGDPERQATVLDTFLTVERPQED
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DBNDD1 dysbindin (dystrobrevin binding protein 1) domain containing 1 [ Homo sapiens ]
• Official Symbol: DBNDD1
• Synonyms: DBNDD1; dysbindin (dystrobrevin binding protein 1) domain containing 1
• Gene ID: 79007
• mRNA Refseq: NM_024043
• Protein Refseq: NP_076948
• UniProt ID: Q9H9R9