Recombinant Full Length Human DCD Protein, C-Flag-tagged
| Cat.No. : | DCD-650HFL |
| Product Overview : | Recombinant Full Length Human DCD Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This antimicrobial gene encodes a secreted protein that is subsequently processed into mature peptides of distinct biological activities. The C-terminal peptide is constitutively expressed in sweat and has antibacterial and antifungal activities. The N-terminal peptide, also known as diffusible survival evasion peptide, promotes neural cell survival under conditions of severe oxidative stress. A glycosylated form of the N-terminal peptide may be associated with cachexia (muscle wasting) in cancer patients. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 9.2 kDa |
| AA Sequence : | MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGL DGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Secreted Protein |
| Full Length : | Full L. |
| Gene Name | DCD dermcidin [ Homo sapiens (human) ] |
| Official Symbol | DCD |
| Synonyms | PIF; AIDD; DSEP; HCAP; DCD-1 |
| Gene ID | 117159 |
| mRNA Refseq | NM_053283.4 |
| Protein Refseq | NP_444513.1 |
| MIM | 606634 |
| UniProt ID | P81605 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCD Products
Required fields are marked with *
My Review for All DCD Products
Required fields are marked with *




