Recombinant Full Length Human DCT Protein, C-Flag-tagged
Cat.No. : | DCT-401HFL |
Product Overview : | Recombinant Full Length Human DCT Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable dopachrome isomerase activity. Involved in response to blue light. Located in intracellular membrane-bounded organelle and plasma membrane. Implicated in oculocutaneous albinism. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 59 kDa |
AA Sequence : | MSPLWWGFLLSCLGCKILPGAQGQFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRP WSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQ FLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRAIDFS HQGPAFVTWHRYHLLCLERDLQRLIGNESFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFS SWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNA LEGFDKADGTLDSQVMSLHNLVHSFLNGTNALPHSAANDPIFVVLHSFTDAIFDEWMKRFNPPADAWPQE LAPIGHNRMYNMVPFFPPVTNEELFLTSDQLGYSYAIDLPVSVEETPGWPTTLLVVMGTLVALVGLFVLL AFLQYRRLRKGYTPLMETHLSSKRYTEEATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Protein Pathways : | Melanogenesis, Metabolic pathways, Tyrosine metabolism |
Full Length : | Full L. |
Gene Name | DCT dopachrome tautomerase [ Homo sapiens (human) ] |
Official Symbol | DCT |
Synonyms | TRP-2; TYRP2 |
Gene ID | 1638 |
mRNA Refseq | NM_001922.5 |
Protein Refseq | NP_001913.2 |
MIM | 191275 |
UniProt ID | P40126 |
◆ Recombinant Proteins | ||
DCT-9099Z | Recombinant Zebrafish DCT | +Inquiry |
RFL18547GF | Recombinant Full Length Chicken L-Dopachrome Tautomerase(Dct) Protein, His-Tagged | +Inquiry |
Dct-2806M | Recombinant Mouse Dct protein, His-SUMO & Myc-tagged | +Inquiry |
DCT-1182H | Recombinant Human DCT Protein, His-SUMO/MYC-tagged | +Inquiry |
DCT-401HFL | Recombinant Full Length Human DCT Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCT-7045HCL | Recombinant Human DCT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCT Products
Required fields are marked with *
My Review for All DCT Products
Required fields are marked with *
0
Inquiry Basket