Recombinant Full Length Human DCTN3 Protein, GST-tagged

Cat.No. : DCTN3-2402HF
Product Overview : Human DCTN3 full-length ORF ( AAH00319, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 176 amino acids
Description : This gene encodes the smallest subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, cytokinesis, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like most other dynactin subunits, exists only as a part of the dynactin complex. It is primarily an alpha-helical protein with very little coiled coil, and binds directly to the largest subunit (p150) of dynactin. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Molecular Mass : 44.88 kDa
AA Sequence : MAGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQAPWGVGVRDEAGSLVEDVGFAQFLSVLHFGPTGPVCGNH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DCTN3 dynactin 3 (p22) [ Homo sapiens ]
Official Symbol DCTN3
Synonyms DCTN3; dynactin 3 (p22); dynactin subunit 3; DCTN 22; p22; dynactin light chain; dynactin 3, isoform 1; dynactin complex subunit 22 kDa subunit; DCTN22; DCTN-22; MGC111190;
Gene ID 11258
mRNA Refseq NM_007234
Protein Refseq NP_009165
MIM 607387
UniProt ID O75935

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DCTN3 Products

Required fields are marked with *

My Review for All DCTN3 Products

Required fields are marked with *

0
cart-icon
0
compare icon