Recombinant Human DCTN3 Protein, GST-tagged
| Cat.No. : | DCTN3-2413H |
| Product Overview : | Human DCTN3 full-length ORF ( AAH00319, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes the smallest subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, cytokinesis, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like most other dynactin subunits, exists only as a part of the dynactin complex. It is primarily an alpha-helical protein with very little coiled coil, and binds directly to the largest subunit (p150) of dynactin. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
| Molecular Mass : | 44.88 kDa |
| AA Sequence : | MAGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQAPWGVGVRDEAGSLVEDVGFAQFLSVLHFGPTGPVCGNH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DCTN3 dynactin 3 (p22) [ Homo sapiens ] |
| Official Symbol | DCTN3 |
| Synonyms | DCTN3; dynactin 3 (p22); dynactin subunit 3; DCTN 22; p22; dynactin light chain; dynactin 3, isoform 1; dynactin complex subunit 22 kDa subunit; DCTN22; DCTN-22; MGC111190; |
| Gene ID | 11258 |
| mRNA Refseq | NM_007234 |
| Protein Refseq | NP_009165 |
| MIM | 607387 |
| UniProt ID | O75935 |
| ◆ Recombinant Proteins | ||
| Dctn3-2482M | Recombinant Mouse Dctn3 Protein, Myc/DDK-tagged | +Inquiry |
| DCTN3-2402HF | Recombinant Full Length Human DCTN3 Protein, GST-tagged | +Inquiry |
| DCTN3-437Z | Recombinant Zebrafish DCTN3 | +Inquiry |
| DCTN3-11866H | Recombinant Human DCTN3, GST-tagged | +Inquiry |
| DCTN3-1195R | Recombinant Rhesus monkey DCTN3 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DCTN3-7041HCL | Recombinant Human DCTN3 293 Cell Lysate | +Inquiry |
| DCTN3-7040HCL | Recombinant Human DCTN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCTN3 Products
Required fields are marked with *
My Review for All DCTN3 Products
Required fields are marked with *



