Recombinant Full Length Human DCUN1D1 Protein, GST-tagged

Cat.No. : DCUN1D1-2410HF
Product Overview : Human DCUN1D1 full-length ORF ( NP_065691.2, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 259 amino acids
Description : DCUN1D1 (Defective In Cullin Neddylation 1 Domain Containing 1) is a Protein Coding gene. Diseases associated with DCUN1D1 include Squamous Cell Carcinoma Of The Oral Tongue and Squamous Cell Carcinoma. An important paralog of this gene is DCUN1D2.
Molecular Mass : 56.5 kDa
AA Sequence : MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DCUN1D1 DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) [ Homo sapiens ]
Official Symbol DCUN1D1
Synonyms DCUN1D1; DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae); DCN1-like protein 1; DCUN1L1; RP42; SCCRO; SCRO; Tes3; RP42 homolog; DCUN1 domain-containing protein 1; squamous cell carcinoma-related oncogene; defective in cullin neddylation protein 1-like protein 1; DCNL1;
Gene ID 54165
mRNA Refseq NM_020640
Protein Refseq NP_065691
MIM 605905
UniProt ID Q96GG9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DCUN1D1 Products

Required fields are marked with *

My Review for All DCUN1D1 Products

Required fields are marked with *

0
cart-icon
0
compare icon