Recombinant Full Length Human DCUN1D1 Protein, GST-tagged
| Cat.No. : | DCUN1D1-2410HF |
| Product Overview : | Human DCUN1D1 full-length ORF ( NP_065691.2, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 259 amino acids |
| Description : | DCUN1D1 (Defective In Cullin Neddylation 1 Domain Containing 1) is a Protein Coding gene. Diseases associated with DCUN1D1 include Squamous Cell Carcinoma Of The Oral Tongue and Squamous Cell Carcinoma. An important paralog of this gene is DCUN1D2. |
| Molecular Mass : | 56.5 kDa |
| AA Sequence : | MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DCUN1D1 DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | DCUN1D1 |
| Synonyms | DCUN1D1; DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae); DCN1-like protein 1; DCUN1L1; RP42; SCCRO; SCRO; Tes3; RP42 homolog; DCUN1 domain-containing protein 1; squamous cell carcinoma-related oncogene; defective in cullin neddylation protein 1-like protein 1; DCNL1; |
| Gene ID | 54165 |
| mRNA Refseq | NM_020640 |
| Protein Refseq | NP_065691 |
| MIM | 605905 |
| UniProt ID | Q96GG9 |
| ◆ Recombinant Proteins | ||
| DCUN1D1-11871H | Recombinant Human DCUN1D1 protein, GST-tagged | +Inquiry |
| DCUN1D1-197H | Recombinant Human DCUN1D1, His tagged | +Inquiry |
| DCUN1D1-510H | Recombinant Human DCUN1D1 Protein, His-tagged | +Inquiry |
| DCUN1D1-2244M | Recombinant Mouse DCUN1D1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DCUN1D1-1199R | Recombinant Rhesus monkey DCUN1D1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DCUN1D1-7035HCL | Recombinant Human DCUN1D1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCUN1D1 Products
Required fields are marked with *
My Review for All DCUN1D1 Products
Required fields are marked with *
