Recombinant Human DCUN1D1 protein, GST-tagged
| Cat.No. : | DCUN1D1-11871H |
| Product Overview : | Recombinant Human DCUN1D1 protein(1-259 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | November 06, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-259 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | DCUN1D1 DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | DCUN1D1 |
| Synonyms | DCUN1D1; DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae); DCN1-like protein 1; DCUN1L1; RP42; SCCRO; SCRO; Tes3; RP42 homolog; DCUN1 domain-containing protein 1; squamous cell carcinoma-related oncogene; defective in cullin neddylation protein 1-like protein 1; DCNL1; |
| Gene ID | 54165 |
| mRNA Refseq | NM_020640 |
| Protein Refseq | NP_065691 |
| MIM | 605905 |
| UniProt ID | Q96GG9 |
| ◆ Recombinant Proteins | ||
| DCUN1D1-2410HF | Recombinant Full Length Human DCUN1D1 Protein, GST-tagged | +Inquiry |
| DCUN1D1-26174TH | Recombinant Human DCUN1D1, His-tagged | +Inquiry |
| DCUN1D1-11871H | Recombinant Human DCUN1D1 protein, GST-tagged | +Inquiry |
| DCUN1D1-510H | Recombinant Human DCUN1D1 Protein, His-tagged | +Inquiry |
| DCUN1D1-4371M | Recombinant Mouse DCUN1D1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DCUN1D1-7035HCL | Recombinant Human DCUN1D1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCUN1D1 Products
Required fields are marked with *
My Review for All DCUN1D1 Products
Required fields are marked with *
