Recombinant Full Length Human DCUN1D2 Protein, GST-tagged
| Cat.No. : | DCUN1D2-2411HF |
| Product Overview : | Human DCUN1D2 full-length ORF ( NP_001014305.1, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 259 amino acids |
| Description : | DCUN1D2 (Defective In Cullin Neddylation 1 Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is DCUN1D1. |
| Molecular Mass : | 56.6 kDa |
| AA Sequence : | MHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVTGGKRSLF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DCUN1D2 DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | DCUN1D2 |
| Synonyms | DCUN1D2; DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae); C13orf17, chromosome 13 open reading frame 17; DCN1-like protein 2; FLJ10704; FLJ20092; DCUN1 domain-containing protein 2; defective in cullin neddylation protein 1-like protein 2; C13orf17; |
| Gene ID | 55208 |
| mRNA Refseq | NM_001014283 |
| Protein Refseq | NP_001014305 |
| UniProt ID | Q6PH85 |
| ◆ Recombinant Proteins | ||
| DCUN1D2-3620H | Recombinant Human DCUN1D2, His-tagged | +Inquiry |
| DCUN1D2-2419H | Recombinant Human DCUN1D2 Protein, GST-tagged | +Inquiry |
| DCUN1D2-2411HF | Recombinant Full Length Human DCUN1D2 Protein, GST-tagged | +Inquiry |
| DCUN1D2-4372M | Recombinant Mouse DCUN1D2 Protein | +Inquiry |
| DCUN1D2-2245M | Recombinant Mouse DCUN1D2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCUN1D2 Products
Required fields are marked with *
My Review for All DCUN1D2 Products
Required fields are marked with *
