Recombinant Human DCUN1D2 Protein, GST-tagged

• Cat.No.: DCUN1D2-2419H
• Product Overview: Human DCUN1D2 full-length ORF ( NP_001014305.1, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: DCUN1D2 (Defective In Cullin Neddylation 1 Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is DCUN1D1.
• Molecular Mass: 56.6 kDa
• AA Sequence: MHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVTGGKRSLF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DCUN1D2 DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: DCUN1D2
• Synonyms: DCUN1D2; DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae); C13orf17, chromosome 13 open reading frame 17; DCN1-like protein 2; FLJ10704; FLJ20092; DCUN1 domain-containing protein 2; defective in cullin neddylation protein 1-like protein 2; C13orf17
• Gene ID: 55208
• mRNA Refseq: NM_001014283
• Protein Refseq: NP_001014305
• UniProt ID: Q6PH85