Recombinant Full Length Human DDI2 Protein, C-Flag-tagged
Cat.No. : | DDI2-1310HFL |
Product Overview : | Recombinant Full Length Human DDI2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables aspartic-type endopeptidase activity; identical protein binding activity; and ubiquitin binding activity. Involved in several processes, including cellular response to hydroxyurea; proteolysis; and regulation of DNA stability. Located in cytosol and nucleoplasm. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 44.3 kDa |
AA Sequence : | MLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGLKDGD VVILRQKENADPRPPVQFPNLPRIDFSSIAVPGTSSPRQRQPPGTQQSHSSPGEITSSPQGLDNPALLRD MLLANPHELSLLKERNPPLAEALLSGDLEKFSRVLVEQQQDRARREQERIRLFSADPFDLEAQAKIEEDI RQQNIEENMTIAMEEAPESFGQVVMLYINCKVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAG IAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEEQPMDMLLGLDMLKRHQCSIDLKKNVLVIGTTGSQT TFLPEGELPECARLAYGAGREDVRPEEIADQELAEALQKSAEDAERQKPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | DDI2 DNA damage inducible 1 homolog 2 [ Homo sapiens (human) ] |
Official Symbol | DDI2 |
Synonyms | RP4-680D5.5 |
Gene ID | 84301 |
mRNA Refseq | NM_032341.5 |
Protein Refseq | NP_115717.3 |
UniProt ID | Q5TDH0 |
◆ Recombinant Proteins | ||
DDI2-1310HFL | Recombinant Full Length Human DDI2 Protein, C-Flag-tagged | +Inquiry |
DDI2-216H | Recombinant Human DDI2 Protein, MYC/DDK-tagged | +Inquiry |
DDI2-9834Z | Recombinant Zebrafish DDI2 | +Inquiry |
DDI2-4386M | Recombinant Mouse DDI2 Protein | +Inquiry |
DDI2-734H | Recombinant Human DDI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDI2-220HCL | Recombinant Human DDI2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDI2 Products
Required fields are marked with *
My Review for All DDI2 Products
Required fields are marked with *
0
Inquiry Basket