Recombinant Full Length Human DDI2 Protein, GST-tagged
Cat.No. : | DDI2-2449HF |
Product Overview : | Human DDI2 full-length ORF ( AAH06011.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 211 amino acids |
Description : | DDI2 (DNA Damage Inducible 1 Homolog 2) is a Protein Coding gene. GO annotations related to this gene include aspartic-type endopeptidase activity. An important paralog of this gene is DDI1. |
Molecular Mass : | 50.1 kDa |
AA Sequence : | MLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGLKDGDVVILRQKENADPRPPVQFPNLPRIDFSSIAVPGTSSPRQRQPPGTQQSHSSPGEITSSPQGLDNPALLRDMLLANPHELSLLKERNPPLAEALLSGDLEKFSRVLVEQQQDRARREQERIRLFSADPFDLEAQAKIEEDIR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DDI2 DNA-damage inducible 1 homolog 2 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | DDI2 |
Synonyms | DDI2; DNA-damage inducible 1 homolog 2 (S. cerevisiae); DDI1, DNA damage inducible 1, homolog 2 (S. cerevisiae); protein DDI1 homolog 2; MGC14844; DNA-damage inducible protein 2 (DDI2); DDI1, DNA-damage inducible 1, homolog 2; RP4-680D5.5; |
Gene ID | 84301 |
mRNA Refseq | NM_032341 |
Protein Refseq | NP_115717 |
UniProt ID | Q5TDH0 |
◆ Recombinant Proteins | ||
DDI2-216H | Recombinant Human DDI2 Protein, MYC/DDK-tagged | +Inquiry |
DDI2-9834Z | Recombinant Zebrafish DDI2 | +Inquiry |
DDI2-2441H | Recombinant Human DDI2 Protein, GST-tagged | +Inquiry |
DDI2-2254M | Recombinant Mouse DDI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDI2-734H | Recombinant Human DDI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDI2-220HCL | Recombinant Human DDI2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDI2 Products
Required fields are marked with *
My Review for All DDI2 Products
Required fields are marked with *