Recombinant Full Length Human DDIT4L Protein, GST-tagged

Cat.No. : DDIT4L-2452HF
Product Overview : Human DDIT4L full-length ORF ( NP_660287.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 193 amino acids
Description : DDIT4L (DNA Damage Inducible Transcript 4 Like) is a Protein Coding gene. Among its related pathways are mTOR signalling. An important paralog of this gene is DDIT4.
Molecular Mass : 48.1 kDa
AA Sequence : MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DDIT4L DNA-damage-inducible transcript 4-like [ Homo sapiens ]
Official Symbol DDIT4L
Synonyms DDIT4L; DNA-damage-inducible transcript 4-like; DNA damage-inducible transcript 4-like protein; similar to Smhs1 protein; REDD2; regulated in development and DNA damage response 2; Rtp801L; REDD-2; homolog of mouse SMHS1; HIF-1 responsive protein RTP801-like; protein regulated in development and DNA damage response 2;
Gene ID 115265
mRNA Refseq NM_145244
Protein Refseq NP_660287
MIM 607730
UniProt ID Q96D03

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DDIT4L Products

Required fields are marked with *

My Review for All DDIT4L Products

Required fields are marked with *

0
cart-icon