Recombinant Human DDIT4L protein, His-tagged

• Cat.No.: DDIT4L-7856H
• Product Overview: Recombinant Human DDIT4L protein(1-99 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-99 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTE

Gene Information

• Gene Name: DDIT4L DNA-damage-inducible transcript 4-like [ Homo sapiens ]
• Official Symbol: DDIT4L
• Synonyms: DDIT4L; DNA-damage-inducible transcript 4-like; DNA damage-inducible transcript 4-like protein; similar to Smhs1 protein; REDD2; regulated in development and DNA damage response 2; Rtp801L; REDD-2; homolog of mouse SMHS1; HIF-1 responsive protein RTP801-like; protein regulated in development and DNA damage response 2
• Gene ID: 115265
• mRNA Refseq: NM_145244
• Protein Refseq: NP_660287
• MIM: 607730
• UniProt ID: Q96D03